VDAC1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19707-5UL
20 ul
£169.00
A19707-20UL
100 ul
£360.00
A19707-100UL
500 ul
£1532.00
A19707-500UL
1000 ul
£2704.00
A19707-1000UL
About this Product
- SKU:
- A19707
- Additional Names:
- PORIN|VDAC-1|VDAC1
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC1 (P21796).
- Isotype:
- IgG
- Molecular Weight:
- 31kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19707
