GABA A Receptor beta 1 (GABRB1) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19681-5UL
20 ul
£164.00
A19681-20UL
100 ul
£342.00
A19681-100UL
500 ul
£1532.00
A19681-500UL
1000 ul
£2704.00
A19681-1000UL
About this Product
- SKU:
- A19681
- Additional Names:
- DEE45|EIEE45|GABA A Receptor beta 1 (GABRB1)
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 54kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- EKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSID
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19681
