PGC1A Alpha/B Beta Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A19674-20UL
100 ul
£342.00
A19674-100UL
About this Product
- SKU:
- A19674
- Additional Names:
- ERRL1|LEM6|PERC|PGC-1(alpha)|PGC-1(beta)|PGC-1alpha|PGC-1v|PGC1|PGC1A|PGC1B|PGC1A Alpha/B Beta|PPARGC1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 113kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- VFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19674
