Engrailed 1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19672-5UL
20 ul
£164.00
A19672-20UL
100 ul
£342.00
A19672-100UL
500 ul
£1532.00
A19672-500UL
1000 ul
£2704.00
A19672-1000UL
About this Product
- SKU:
- A19672
- Additional Names:
- ENDOVESLB|Engrailed 1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- KLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19672
