TACC3 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19617-5UL
20 ul
£164.00
A19617-20UL
100 ul
£342.00
A19617-100UL
500 ul
£1532.00
A19617-500UL
1000 ul
£2704.00
A19617-1000UL
About this Product
- SKU:
- A19617
- Additional Names:
- ERIC-1|ERIC1|maskin|TACC3|Tacc4
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- TACC3, also known as ERIC 1, belongs to the TACC family. TACC family members TACC1, TACC2, and TACC3 map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 8, 10, and 4. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. It plays a role in the microtubule-dependent coupling of the nucleus and the centrosome and involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 140 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19617
