[KD Validated] Vimentin Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19607-5UL
20 ul
£169.00
A19607-20UL
100 ul
£360.00
A19607-100UL
500 ul
£1532.00
A19607-500UL
1000 ul
£2704.00
A19607-1000UL
About this Product
- SKU:
- A19607
- Additional Names:
- CTRCT30|HEL113|in|VIM|Vimentin
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50-60 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- DEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19607
