MAD2L1BP Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19600-5UL
20 ul
£164.00
A19600-20UL
100 ul
£342.00
A19600-100UL
500 ul
£1532.00
A19600-500UL
1000 ul
£2704.00
A19600-1000UL
About this Product
- SKU:
- A19600
- Additional Names:
- CMT2|MAD2L1BP
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 175-274 of human MAD2L1BP (Q15013).
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- YSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19600
