NFAT2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19597-5UL
20 ul
£164.00
A19597-20UL
100 ul
£342.00
A19597-100UL
500 ul
£1532.00
A19597-500UL
1000 ul
£2704.00
A19597-1000UL
About this Product
- SKU:
- A19597
- Additional Names:
- NF-ATC|NF-ATc1.2|NFAT2|NFATc
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 70-140kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- PSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19597
