HDAC1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19571-5UL
20 ul
£164.00
A19571-20UL
100 ul
£342.00
A19571-100UL
500 ul
£1532.00
A19571-500UL
1000 ul
£2704.00
A19571-1000UL
About this Product
- SKU:
- A19571
- Additional Names:
- C1|GON-10|HD1|KDAC1|RPD3|RPD3L1
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19571
