BRG1/SMARCA4 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19556-5UL
20 ul
£164.00
A19556-20UL
100 ul
£342.00
A19556-100UL
500 ul
£1532.00
A19556-500UL
1000 ul
£2704.00
A19556-1000UL
About this Product
- SKU:
- A19556
- Additional Names:
- BAF190|BAF190A|BRG1|BRG1/SMARCA4|CSS4|hSNF2b|MRD16|RTPS2|SNF2|SNF2-beta|SNF2L4|SNF2LB|SWI2
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI,which is required for transcriptional activation of genes normally repressed by chromatin. In addition,this protein can bind BRCA1,as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 220 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- LQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19556
