PP2A-B56B Beta/PR61B Beta/PPP2R5B Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A19332-20UL
100 ul
£336.00
A19332-100UL
500 ul
£1258.00
A19332-500UL
1000 ul
£2228.00
A19332-1000UL
About this Product
- SKU:
- A19332
- Additional Names:
- B56B|B56beta|PP2A-B56B Beta/PR61B Beta/PPP2R5B|PR61B
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B56 subfamily.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 57kda
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- AVFGTLYQVSKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTPQVAASGGQS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A19332
