Human EG-VEGF/PK1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19268-5UL
20 ul
£164.00
A19268-20UL
100 ul
£342.00
A19268-100UL
500 ul
£1532.00
A19268-500UL
1000 ul
£2704.00
A19268-1000UL
About this Product
- SKU:
- A19268
- Additional Names:
- EGVEGF|PK1|PRK1|PROK1
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and non-endothelial cell types. Its expression is restricted to the steroidogenic glands (ovary, testis, adrenal, and placenta), is induced by hypoxia, and often complementary to the expression of vascular endothelial growth factor (VEGF), suggesting that these molecules function in a coordinated manner.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19268
