Osteopontin Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19092-5UL
20 ul
£164.00
A19092-20UL
100 ul
£342.00
A19092-100UL
500 ul
£1532.00
A19092-500UL
1000 ul
£2704.00
A19092-1000UL
About this Product
- SKU:
- A19092
- Additional Names:
- BNSP|BSPI|ETA-1|OPN|Osteopontin
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35kDa/65kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- GAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19092
