NeuN Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19086-5UL
20 ul
£169.00
A19086-20UL
100 ul
£360.00
A19086-100UL
500 ul
£1532.00
A19086-500UL
1000 ul
£2704.00
A19086-1000UL
About this Product
- SKU:
- A19086
- Additional Names:
- FOX-3|FOX3|HRNBP3|NEUN
- Application:
- Detection/Quantitation, ELISA, IHC-Paraffin, Immunofluorescence, Immunohistochemistry, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 46-55 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19086
