Integrin beta 3 (ITGB3/CD61) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19073-5UL
20 ul
£164.00
A19073-20UL
100 ul
£342.00
A19073-100UL
500 ul
£1532.00
A19073-500UL
1000 ul
£2704.00
A19073-1000UL
About this Product
- SKU:
- A19073
- Additional Names:
- BDPLT16|BDPLT2|BDPLT24|CD61|GP3A|GPIIIa|GT|GT2|Integrin beta 3 (ITGB3/CD61)
- Application:
- ELISA, Flow Cytometry, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 100 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- CVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19073
