Integrin alpha 5 (ITGA5/CD49e) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19069-5UL
20 ul
£164.00
A19069-20UL
100 ul
£342.00
A19069-100UL
500 ul
£1532.00
A19069-500UL
1000 ul
£2704.00
A19069-1000UL
About this Product
- SKU:
- A19069
- Additional Names:
- CD49e|FNRA|Integrin alpha 5 (ITGA5/CD49e)|VLA-5|VLA5A
- Application:
- ELISA, Flow Cytometry, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 5 subunit. This subunit associates with the beta 1 subunit to form a fibronectin receptor. This integrin may promote tumor invasion, and higher expression of this gene may be correlated with shorter survival time in lung cancer patients. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 150kDa (Full-length)/17kDa (light chain)
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19069
