FGFR3 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19052-5UL
20 ul
£164.00
A19052-20UL
100 ul
£342.00
A19052-100UL
500 ul
£1532.00
A19052-500UL
1000 ul
£2704.00
A19052-1000UL
About this Product
- SKU:
- A19052
- Additional Names:
- ACH|CD333|CEK2|FGFR3|HSFGFR3EX|JTK4
- Application:
- ELISA, IHC-Paraffin
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to Figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19052
