Cytokeratin 20 (CK20) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19041-5UL
20 ul
£164.00
A19041-20UL
100 ul
£342.00
A19041-100UL
500 ul
£1532.00
A19041-500UL
1000 ul
£2704.00
A19041-1000UL
About this Product
- SKU:
- A19041
- Additional Names:
- CD20|CK-20|Cytokeratin 20 (CK20)|K20|KRT20|KRT21
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 48 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- LANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19041
