CD14 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19011-5UL
20 ul
£164.00
A19011-20UL
100 ul
£342.00
A19011-100UL
500 ul
£1532.00
A19011-500UL
1000 ul
£2704.00
A19011-1000UL
About this Product
- SKU:
- A19011
- Additional Names:
- CD14
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- QPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19011
