C1orf146 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18804-20UL
100 ul
£336.00
A18804-100UL
500 ul
£1258.00
A18804-500UL
1000 ul
£2228.00
A18804-1000UL
About this Product
- SKU:
- A18804
- Additional Names:
- C1orf146|SCRE|Spo16
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Involved in reciprocal meiotic recombination and synaptonemal complex assembly. Located in chromosome. Is expressed in ovary; spermatid; spermatocyte; spermatogonium; and testis. Orthologous to human C1orf146 (chromosome 1 open reading frame 146).
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- GSIVFSLSGVAFLLMDAKECMTSAEEIFVTKIEKFINIHQNSFLVLFAPLHGPEEWSLMFRIHQRFLGSNLRILPVHNTVNALDLMCTIAKTTSKPHIDSICYRMITTKAYIIEQSPVWRTLQKIKL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18804
