FFAR4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18689-20UL
100 ul
£336.00
A18689-100UL
500 ul
£1258.00
A18689-500UL
1000 ul
£2228.00
A18689-1000UL
About this Product
- SKU:
- A18689
- Additional Names:
- BMIQ10|FFAR4|GPR120|GPR129|GT01|O3FAR1|OB10Q|PGR4
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- NPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18689
