CXCL9 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A1864-20UL
100 ul
£336.00
A1864-100UL
500 ul
£1258.00
A1864-500UL
1000 ul
£2228.00
A1864-1000UL
About this Product
- SKU:
- A1864
- Additional Names:
- CMK|crg-10|CXCL9|Humig|MIG|SCYB9
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A1864
