SLC22A3/OCT3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18588-20UL
100 ul
£336.00
A18588-100UL
500 ul
£1258.00
A18588-500UL
1000 ul
£2228.00
A18588-1000UL
About this Product
- SKU:
- A18588
- Additional Names:
- EMT|EMTH|OCT3|SLC22A3/OCT3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 61kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- PESPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18588
