POU3F2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18576-20UL
100 ul
£336.00
A18576-100UL
500 ul
£1258.00
A18576-500UL
1000 ul
£2228.00
A18576-1000UL
About this Product
- SKU:
- A18576
- Additional Names:
- brn-2|BRN2|N-Oct3|oct-7|OCT7|OTF-7|OTF7|POU3F2|POUF3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18576
