PPP2R1A/PPP2R2A/PPP2R1B Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18571-20UL
100 ul
£336.00
A18571-100UL
500 ul
£1258.00
A18571-500UL
1000 ul
£2228.00
A18571-1000UL
About this Product
- SKU:
- A18571
- Additional Names:
- PPP2R1A/PPP2R2A/PPP2R1B
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.The B regulatory subunit might modulate substrate selectivity and catalytic activity.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55kDa/66kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18571
