Topors Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18526-20UL
100 ul
£336.00
A18526-100UL
500 ul
£1258.00
A18526-500UL
1000 ul
£2228.00
A18526-1000UL
About this Product
- SKU:
- A18526
- Additional Names:
- LUN|p53BP3/LUN|Topors|TP53BPL
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable several functions, including DNA topoisomerase binding activity; antigen binding activity; and ubiquitin-like protein transferase activity. Acts upstream of or within intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator; positive regulation of transcription, DNA-templated; and regulation of cell population proliferation. Located in ciliary basal body; nucleus; and photoreceptor connecting cilium. Is expressed in skin. Human ortholog(s) of this gene implicated in retinitis pigmentosa 31. Orthologous to human TOPORS (TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase).
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 119kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18526
