CELF5 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18482-20UL
100 ul
£336.00
A18482-100UL
500 ul
£1258.00
A18482-500UL
1000 ul
£2228.00
A18482-1000UL
About this Product
- SKU:
- A18482
- Additional Names:
- BRUNOL-5|BRUNOL5|CELF-5|CELF5
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a member of the the CELF/BRUNOL protein family, which contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing and translation. Alternatively spliced transcript variants have been found for this gene.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 52kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18482
