SERINC1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18478-20UL
100 ul
£336.00
A18478-100UL
500 ul
£1258.00
A18478-500UL
1000 ul
£2228.00
A18478-1000UL
About this Product
- SKU:
- A18478
- Additional Names:
- SERINC1|TDE1L|TDE2|TMS-2|TMS2
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in several processes, including phosphatidylserine metabolic process; positive regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity; and positive regulation of serine C-palmitoyltransferase activity. Predicted to be located in endoplasmic reticulum membrane and plasma membrane. Predicted to be active in membrane.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- ESTLIEDGGARSDGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQWTAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18478
