IER5 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18457-20UL
100 ul
£336.00
A18457-100UL
500 ul
£1258.00
A18457-500UL
1000 ul
£2228.00
A18457-1000UL
About this Product
- SKU:
- A18457
- Additional Names:
- IER5|SBBI48
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene to be increased after waking and sleep deprivation.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 34kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- APQPAEDEPPAPPAVCPRKRCAAGVGGGPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18457
