TLE4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18345-20UL
100 ul
£336.00
A18345-100UL
500 ul
£1258.00
A18345-500UL
1000 ul
£2228.00
A18345-1000UL
About this Product
- SKU:
- A18345
- Additional Names:
- BCE-1|BCE1|E(spI)|E(spl)|ESG|ESG4|Grg-4|GRG4|TLE4
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable transcription corepressor activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway. Predicted to act upstream of or within Wnt signaling pathway; cellular response to leukemia inhibitory factor; and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of beta-catenin-TCF complex.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 84kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18345
