GYPA Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A1827-20UL
100 ul
£336.00
A1827-100UL
500 ul
£1258.00
A1827-500UL
1000 ul
£2228.00
A1827-1000UL
About this Product
- SKU:
- A1827
- Additional Names:
- CD235a|GPA|GPErik|GPSAT|GYPA|HGpMiV|HGpMiXI|HGpSta(C)|MN|MNS|PAS-2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A1827
