Tulp2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18256-20UL
100 ug
£336.00
A18256-100UG
500 ul
£1258.00
A18256-500UL
1000 ul
£2228.00
A18256-1000UL
About this Product
- SKU:
- A18256
- Additional Names:
- Pdet|Tulp2
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable phosphoric diester hydrolase activity. Predicted to be involved in protein localization to cilium. Predicted to be located in cytoplasm and extracellular region. Predicted to be active in cilium. Is expressed in urogenital ridge. Orthologous to human TULP2 (TUB like protein 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 60kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- FQSDSSWGLGVGSPFLQENVPQAHLPSGAHSALVTMSYVADGSGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEVTMEDIPVISRPPQTNLANLRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPDPTVNSDGDHGDLAPCKVEENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQGDDGDASNHNAWNMTCPQPRIPGPRLG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18256
