DEFA5 Rabbit polyclonal antibody
Product Sizes
5 ul
£ POA
A18208-5UL
20 ul
£152.00
A18208-20UL
100 ul
£336.00
A18208-100UL
500 ul
£1258.00
A18208-500UL
1000 ul
£2228.00
A18208-1000UL
About this Product
- SKU:
- A18208
- Additional Names:
- DEF5|DEFA5|HD-5
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 12kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18208
