Mrpl18 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A18186-20UL
100 ul
£336.00
A18186-100UL
500 ul
£1258.00
A18186-500UL
1000 ul
£2228.00
A18186-1000UL
About this Product
- SKU:
- A18186
- Additional Names:
- 1010001C05Rik|HSPC071|MRP-L18|Mrpl18
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable 5S rRNA binding activity. Predicted to be involved in rRNA import into mitochondrion. Located in mitochondrion. Is expressed in several structures, including brain; connective tissue; early conceptus; genitourinary system; and gut. Orthologous to human MRPL18 (mitochondrial ribosomal protein L18).
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 18kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- EAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A18186
