Caspase-3 Mouse monoclonal antibody
Product Sizes
20 ul
£164.00
A17900-20UL
100 ug
£342.00
A17900-100UG
About this Product
- SKU:
- A17900
- Additional Names:
- Caspase-3|CPP32|CPP32B|SCA-1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG1, kappa
- Molecular Weight:
- 32kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A17900
