PGLYRP2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17814-20UL
100 ul
£336.00
A17814-100UL
500 ul
£1258.00
A17814-500UL
1000 ul
£2228.00
A17814-1000UL
About this Product
- SKU:
- A17814
- Additional Names:
- HMFT0141|PGLYRP2|PGLYRPL|PGRP-L|PGRPL|tagL|tagL-alpha|tagl-beta|TAGL-like
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 62kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17814
