MARVELD1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17787-20UL
100 ul
£336.00
A17787-100UL
500 ul
£1258.00
A17787-500UL
1000 ul
£2228.00
A17787-1000UL
About this Product
- SKU:
- A17787
- Additional Names:
- bA548K23.8|GB14|MARVD1|MARVELD1|MRVLDC1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in several cellular components, including cytoskeleton; nucleus; and plasma membrane. Predicted to be integral component of membrane.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 19kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17787
