ZNF426 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17764-20UL
100 ul
£336.00
A17764-100UL
500 ul
£1258.00
A17764-500UL
1000 ul
£2228.00
A17764-1000UL
About this Product
- SKU:
- A17764
- Additional Names:
- K-RBP|ZNF426
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Kaposi's sarcoma-associated herpesvirus (KSHV) can be reactivated from latency by the viral protein RTA. The protein encoded by this gene is a zinc finger transcriptional repressor that interacts with RTA to modulate RTA-mediated reactivation of KSHV. While the encoded protein can repress KSHV reactivation, RTA can induce degradation of this protein through the ubiquitin-proteasome pathway to overcome the repression. Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 63kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QCGEVFSEHSCLKTHVRTQSTGNTHDCNQYGKDFLTLCEKTSTGEKLSEFNQSEKIFSLTPNIVYQRTSTQEKSFECSHCGKSFINESYLQAHMRTHNGEKLYEWRNYGPGFIDSTSLSVL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17764
