PCNX1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17647-20UL
100 ul
£336.00
A17647-100UL
500 ul
£1258.00
A17647-500UL
1000 ul
£2228.00
A17647-1000UL
About this Product
- SKU:
- A17647
- Additional Names:
- PCNX|PCNX1|PCNXL1|pecanex
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes an evolutionarily conserved transmembrane protein similar to the pecanex protein in Drosophila. The fly protein is a component of the Notch signaling pathway, which functions in several developmental processes.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 290kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- VDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17647
