SYNJ1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17581-20UL
100 ul
£336.00
A17581-100UL
500 ul
£1258.00
A17581-500UL
1000 ul
£2228.00
A17581-1000UL
About this Product
- SKU:
- A17581
- Additional Names:
- DEE53|EIEE53|INPP5G|PARK20|SYNJ1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 140kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17581
