Galectin 4/LGALS4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17417-20UL
100 ul
£336.00
A17417-100UL
500 ul
£1258.00
A17417-500UL
1000 ul
£2228.00
A17417-1000UL
About this Product
- SKU:
- A17417
- Additional Names:
- GAL4|Galectin 4/LGALS4|L36LBP
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 36kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17417
