TAS1R2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17218-20UL
100 ul
£336.00
A17218-100UL
500 ul
£1258.00
A17218-500UL
1000 ul
£2228.00
A17218-1000UL
About this Product
- SKU:
- A17218
- Additional Names:
- GPR71|T1R2|TAS1R2|TR2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Contributes to sweet taste receptor activity. Involved in detection of chemical stimulus involved in sensory perception of sweet taste and positive regulation of cytokinesis. Part of sweet taste receptor complex.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 95kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17218
