CPSF1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17144-20UL
100 ul
£336.00
A17144-100UL
500 ul
£1258.00
A17144-500UL
1000 ul
£2228.00
A17144-1000UL
About this Product
- SKU:
- A17144
- Additional Names:
- CPSF1|CPSF160|HSU37012|MYP27|P/cl.18
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Cleavage and polyadenylation specificity factor (CPSF) is a multisubunit complex that plays a central role in 3-prime processing of pre-mRNAs. CPSF recognizes the AAUAAA signal in the pre-mRNA and interacts with other proteins to facilitate both RNA cleavage and poly(A) synthesis. CPSF1 is the largest subunit of the CPSF complex (Murthy and Manley, 1995 [PubMed 7590244]).
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 170kDa/185kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- LYRDLSGMFTTESRLGGARDELGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAEPTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNINFREKKPKPSKKKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17144
