TAOK2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A17048-20UL
100 ul
£336.00
A17048-100UL
500 ul
£1258.00
A17048-500UL
1000 ul
£2228.00
A17048-1000UL
About this Product
- SKU:
- A17048
- Additional Names:
- MAP3K17|PSK|PSK1|PSK1-BETA|TAO1|TAO2|Tao2beta|TAOK2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables mitogen-activated protein kinase kinase binding activity; neuropilin binding activity; and protein serine/threonine kinase activity. Involved in several processes, including focal adhesion assembly; intracellular signal transduction; and positive regulation of JNK cascade. Located in cytoplasmic vesicle; cytosol; and nuclear lumen. Part of receptor complex.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 138kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A17048
