CD73/NT5E Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16936-20UL
100 ul
£336.00
A16936-100UL
500 ul
£1258.00
A16936-500UL
1000 ul
£2228.00
A16936-1000UL
About this Product
- SKU:
- A16936
- Additional Names:
- CALJA|CD73|CD73/NT5E|E5NT|eN|eNT|NT|NT5|NTE
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 70kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16936
