Gsdmc3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16741-20UL
100 ug
£336.00
A16741-100UG
500 ul
£1258.00
A16741-500UL
1000 ul
£2228.00
A16741-1000UL
About this Product
- SKU:
- A16741
- Additional Names:
- 9930109F21Rik|Gsdmc3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Predicted to be involved in defense response to bacterium and pyroptosis. Predicted to act upstream of or within programmed cell death. Predicted to be located in cytoplasm. Is expressed in gut and metanephros. Orthologous to human GSDMC (gasdermin C).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 54kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- GYSFDRASKDVVKKLQGRDLRPVECLSDATKFRLFHILQETPRSGWETEDIPVGFTLLDLLEPNFPVPEPEVSAPKPFI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16741
