CCL4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A1671-20UL
100 ul
£336.00
A1671-100UL
500 ul
£1258.00
A1671-500UL
1000 ul
£2228.00
A1671-1000UL
About this Product
- SKU:
- A1671
- Additional Names:
- ACT2|AT744.1|CCL4|G-26|HC21|LAG-1|LAG1|MIP-1-beta|MIP1B|MIP1B1|SCYA2|SCYA4
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 12 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A1671
