Epn2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16623-20UL
100 ul
£336.00
A16623-100UL
500 ul
£1258.00
A16623-500UL
1000 ul
£2228.00
A16623-1000UL
About this Product
- SKU:
- A16623
- Additional Names:
- 9530051D10Rik|Epn2|Ibp2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable clathrin binding activity and phospholipid binding activity. Acts upstream of or within Notch signaling pathway; embryonic organ development; and in utero embryonic development. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be part of clathrin coat of endocytic vesicle. Predicted to be active in endosome and plasma membrane. Orthologous to human EPN2 (epsin 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 68kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- IFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16623
