Cpsf4l Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16622-20UL
100 ul
£336.00
A16622-100UL
500 ul
£1258.00
A16622-500UL
1000 ul
£2228.00
A16622-1000UL
About this Product
- SKU:
- A16622
- Additional Names:
- 0610010C04Rik|1500000C01Rik|Cpsf4l|D11Ertd636e
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to be involved in pre-mRNA cleavage required for polyadenylation. Predicted to be part of mRNA cleavage and polyadenylation specificity factor complex. Is expressed in central nervous system and retina. Orthologous to human CPSF4L (cleavage and polyadenylation specific factor 4 like).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDKSSSAVCNFFAKGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYFTGFCPEGPQCQFGHPKMSPPFHPSNVKLQPVNQPWDSTTSTGNTLVSPFQAKPMVHGQRRWSLPQACSSRAHPAP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16622
