Slc31a2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16362-20UL
100 ul
£336.00
A16362-100UL
500 ul
£1258.00
A16362-500UL
1000 ul
£2228.00
A16362-1000UL
About this Product
- SKU:
- A16362
- Additional Names:
- CTR2|Slc31a2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Acts upstream of or within cellular copper ion homeostasis and regulation of copper ion transmembrane transport. Located in late endosome; membrane; and recycling endosome. Is expressed in brain; retina nuclear layer; and urinary system. Orthologous to human SLC31A2 (solute carrier family 31 member 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 16kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16362
